PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G10650.1
Common NameLOC102711733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 322aa    MW: 35630.8 Da    PI: 10.5262
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G10650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind371.51.5e-11313221301
     GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki........rernlalsekkaavaerd.............maflqrdkalaernka 73 
                   mddd++++ r +g ++++    ++nlglqlmss++ +rd+k+        +  +   +++++ +++rd             ++f++ d++++   ++
  OB10G10650.1   1 MDDDANMSmRGWGsFFNSP---ARNLGLQLMSSVPaDRDTKQllsatpflQ--H--HHHHHHHHQPRDsvpnaavpteppsINFVRGDMWMHP--QQ 88 
                   9*****999****999988...78**********99******655433211..1..122333334444999999*******************..88 PP

     GAGA_bind  74 lverdnkllalllvensla..salpvgvqvlsgtksidslqqlse..pqledsave.lreeeklealpieeaaeeakekk.kkkkrqrakkpkekka 164
                   +++r+ k+l+ l v ++    +++pv++++++gt+ +++lq++++  pq ++++ + +++ee+++++ iee+++ ++e++  +kkrq++++pk+ + 
  OB10G10650.1  89 HHPREPKVLHTLAVGHGGHvpHHDPVAYGMIPGTHAAQTLQMMQQpdPQPQQPPPPpVPKEECISSPMIEENVPIVNEQPpPPKKRQQGRQPKVARP 185
                   99**************98889*********************888676666555555****************988776516789999********* PP

     GAGA_bind 165 kkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKm 260
                   kk+kk +++ +++ +++  + +r++ +kk i++v+ng++lD s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKm
  OB10G10650.1 186 KKPKK-PAAAREDGAPNPPPaPRRRGPKKAIGMVINGIDLDLSRIPTPVCSCTGSPQQCYRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKM 281
                   *****.5555566555555569*************************************************************************** PP

     GAGA_bind 261 SqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                   S+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  OB10G10650.1 282 SHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 322
                   ****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.5E-1751322IPR010409GAGA-binding transcriptional activator
PfamPF062173.9E-1231322IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDDDANMSMR GWGSFFNSPA RNLGLQLMSS VPADRDTKQL LSATPFLQHH HHHHHHHQPR  60
DSVPNAAVPT EPPSINFVRG DMWMHPQQHH PREPKVLHTL AVGHGGHVPH HDPVAYGMIP  120
GTHAAQTLQM MQQPDPQPQQ PPPPPVPKEE CISSPMIEEN VPIVNEQPPP PKKRQQGRQP  180
KVARPKKPKK PAAAREDGAP NPPPAPRRRG PKKAIGMVIN GIDLDLSRIP TPVCSCTGSP  240
QQCYRWGAGG WQSACCTTTI STYPLPMSTK RRGARIAGRK MSHGAFKKVL EKLAGEGYNL  300
NNPIDLKTFW AKHGTNKFVT IR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126181e-158CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661609.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015697361.10.0PREDICTED: barley B recombinant-like protein A
SwissprotP0DH881e-155BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH891e-155BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLJ3N0L70.0J3N0L7_ORYBR; Uncharacterized protein
STRINGOB10G10650.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.39e-60basic pentacysteine 2